Product Browser

Last updated: 2017/8/20
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IKZF4 monoclonal antibody (M01A), clone 4E6

  • Catalog # : H00064375-M01A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant IKZF4.
  • Immunogen:
  • IKZF4 (NP_071910, 2 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • DSRYLQLQLYLPSCSLLQGSGDSSLEKEFLGAPVGPSVSTPNSQHSSPSRSLSANSIKVEMYSDEESSRLLGPDERLLEKDDSVIVEDSLSEPLGYCDGSGPEPHSP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgM Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00064375-M01A
    Western Blot detection against Immunogen (37.51 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of IKZF4 expression in transfected 293T cell line by IKZF4 monoclonal antibody (M01A), clone 4E6.

    Lane 1: IKZF4 transfected lysate (Predicted MW: 59.7 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • IKZF4
  • Gene Alias:
  • EOS,KIAA1782,ZNFN1A4
  • Gene Description:
  • IKAROS family zinc finger 4 (Eos)
  • Gene Summary:
  • Members of the Ikaros (ZNFN1A1; MIM 603023) family of transcription factors, which includes Eos, are expressed in lymphocytes and are implicated in the control of lymphoid development.[supplied by OMIM
  • Other Designations:
  • zinc finger protein, subfamily 1A, 4,zinc finger protein, subfamily 1A, 4 (Eos),zinc finger transcription factor Eos
  • RSS
  • YouTube
  • Linkedin
  • Facebook