LMBR1 monoclonal antibody (M05), clone 4A1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LMBR1 is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (34.76 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LMBR1.
Immunogen
LMBR1 (NP_071903, 214 a.a. ~ 295 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SRMFTVMGQLLVKPTILEDLDEQIYIITLEEEALQRRLNGLSSSVEYNIMELEQELENVKTLKTKLERRKKASAWERNLVYP
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.76 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LMBR1 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — LMBR1
Entrez GeneID
64327GeneBank Accession#
NM_022458Protein Accession#
NP_071903Gene Name
LMBR1
Gene Alias
ACHP, C7orf2, DIF14, FLJ11665, PPD2, TPT
Gene Description
limb region 1 homolog (mouse)
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the LMBR1-like membrane protein family. Another member of this protein family has been shown to be a lipocalin transmembrane receptor. A highly conserved, cis-acting regulatory module for the sonic hedgehog gene is located within an intron of this gene. Consequently, disruption of this genic region can alter sonic hedgehog expression and affect limb patterning, but it is not known if this gene functions directly in limb development. Mutations and chromosomal deletions and rearrangements in this genic region are associated with acheiropody and preaxial polydactyly, which likely result from altered sonic hedgehog expression. [provided by RefSeq
Other Designations
differentiation-related gene 14|limb region 1 protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com