RFWD2 monoclonal antibody (M01J), clone 1E4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RFWD2 monoclonal antibody (M01J), clone 1E4. Western Blot analysis of RFWD2 expression in K-562.
Western Blot (Cell lysate)
RFWD2 monoclonal antibody (M01J), clone 1E4. Western Blot analysis of RFWD2 expression in NIH/3T3.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RFWD2 is 0.03 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to RFWD2 on NIH/3T3 cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RFWD2.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
RFWD2 (NP_071902, 632 a.a. ~ 731 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (97); Rat (99)
Preparation Method
Cell Culture Production
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RFWD2 monoclonal antibody (M01J), clone 1E4. Western Blot analysis of RFWD2 expression in K-562.Western Blot (Cell lysate)
RFWD2 monoclonal antibody (M01J), clone 1E4. Western Blot analysis of RFWD2 expression in NIH/3T3.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RFWD2 is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RFWD2 on NIH/3T3 cell . [antibody concentration 10 ug/ml] -
Gene Info — RFWD2
Entrez GeneID
64326GeneBank Accession#
NM_022457Protein Accession#
NP_071902Gene Name
RFWD2
Gene Alias
COP1, FLJ10416, RNF200
Gene Description
ring finger and WD repeat domain 2
Omim ID
608067Gene Ontology
HyperlinkOther Designations
OTTHUMP00000032911|OTTHUMP00000060611|constitutive photomorphogenic protein (COP1)|putative ubiquitin ligase COP1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com