NSD1 monoclonal antibody (M08), clone 4F1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NSD1.
Immunogen
NSD1 (NP_071900, 2 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNAYGQDSPSCYIPLRRLQDLASMINVEYLNGSADGSESFQDPEKSDSRAQT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (42)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NSD1 is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — NSD1
Entrez GeneID
64324GeneBank Accession#
NM_022455Protein Accession#
NP_071900Gene Name
NSD1
Gene Alias
ARA267, DKFZp666C163, FLJ10684, FLJ22263, FLJ44628, KMT3B, SOTOS, STO
Gene Description
nuclear receptor binding SET domain protein 1
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein containing a SET domain, 2 LXXLL motifs, 3 nuclear translocation signals (NLSs), 4 plant homeodomain (PHD) finger regions, and a proline-rich region. The encoded protein enhances androgen receptor (AR) transactivation, and this enhancement can be increased further in the presence of other androgen receptor associated coregulators. This protein may act as a nucleus-localized, basic transcriptional factor and also as a bifunctional transcriptional regulator. Mutations of this gene have been associated with Sotos syndrome and Weaver syndrome. One version of childhood acute myeloid leukemia is the result of a cryptic translocation with the breakpoints occurring within nuclear receptor-binding Su-var, enhancer of zeste, and trithorax domain protein 1 on chromosome 5 and nucleoporin, 98-kd on chromosome 11. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
androgen receptor-associated coregulator 267
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Regulation of NF-kappaB by NSD1/FBXL11-dependent reversible lysine methylation of p65.
Lu T, Jackson MW, Wang B, Yang M, Chance MR, Miyagi M, Gudkov AV, Stark GR.
PNAS 2010 Jan; 107(1):46.
Application:IP, WB-Tr, Human, 293C6, HT-29 cells.
-
Regulation of NF-kappaB by NSD1/FBXL11-dependent reversible lysine methylation of p65.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com