MS4A6A purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MS4A6A expression in transfected 293T cell line (H00064231-T01) by MS4A6A MaxPab polyclonal antibody.
Lane 1: MS4A6A transfected lysate(27.39 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MS4A6A protein.
Immunogen
MS4A6A (AAH22854, 1 a.a. ~ 248 a.a) full-length human protein.
Sequence
MTSQPVPNETIIVPPSNVINFSQAEKPEPTNQGQDSLKKHLHAEIKVIGTIQILCGMMVLSLGIILASASFSPNFTQVTSTLLNSAYPFIGPFFFIISGSLSIATEKRLTKLLVHSSLVGSILSALSALVGFIILSVKQATLNPASLQCELDKNNIPTRSYVSYFYHDSLYTTDCYTAKASLAGSLSLMLICTLLEFCLAVLTAVLRWKQAYSDFPGSVLFLPHSYIGNSGMSSKMTHDCGYEELLTS
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MS4A6A expression in transfected 293T cell line (H00064231-T01) by MS4A6A MaxPab polyclonal antibody.
Lane 1: MS4A6A transfected lysate(27.39 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MS4A6A
Entrez GeneID
64231GeneBank Accession#
BC022854Protein Accession#
AAH22854Gene Name
MS4A6A
Gene Alias
4SPAN3, 4SPAN3.2, CD20L3, CDA01, MGC131944, MGC22650, MS4A6, MST090, MSTP090
Gene Description
membrane-spanning 4-domains, subfamily A, member 6A
Omim ID
606548Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.1, among a cluster of family members. Alternative splicing of this gene results in several transcript variants. [provided by RefSeq
Other Designations
CD20-like precusor|HAIRB-iso|MS4A6A-polymorph|four-span transmembrane protein 3.1|four-span transmembrane protein 3.2|membrane-spanning 4-domains, subfamily A, member 6A, isoform 2
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com