Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MS4A6A purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00064231-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human MS4A6A protein.
  • Immunogen:
  • MS4A6A (AAH22854, 1 a.a. ~ 248 a.a) full-length human protein.
  • Sequence:
  • MTSQPVPNETIIVPPSNVINFSQAEKPEPTNQGQDSLKKHLHAEIKVIGTIQILCGMMVLSLGIILASASFSPNFTQVTSTLLNSAYPFIGPFFFIISGSLSIATEKRLTKLLVHSSLVGSILSALSALVGFIILSVKQATLNPASLQCELDKNNIPTRSYVSYFYHDSLYTTDCYTAKASLAGSLSLMLICTLLEFCLAVLTAVLRWKQAYSDFPGSVLFLPHSYIGNSGMSSKMTHDCGYEELLTS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MS4A6A expression in transfected 293T cell line (H00064231-T01) by MS4A6A MaxPab polyclonal antibody.

    Lane 1: MS4A6A transfected lysate(27.39 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • MS4A6A
  • Gene Alias:
  • 4SPAN3,4SPAN3.2,CD20L3,CDA01,MGC131944,MGC22650,MS4A6,MST090,MSTP090
  • Gene Description:
  • membrane-spanning 4-domains, subfamily A, member 6A
  • Gene Summary:
  • This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.1, among a cluster of family members. Alternative splicing of this gene results in several transcript variants. [provided by RefSeq
  • Other Designations:
  • CD20-like precusor,HAIRB-iso,MS4A6A-polymorph,four-span transmembrane protein 3.1,four-span transmembrane protein 3.2,membrane-spanning 4-domains, subfamily A, member 6A, isoform 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook