Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MLST8 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00064223-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human MLST8 protein.
  • Immunogen:
  • MLST8 (NP_071767.3, 1 a.a. ~ 326 a.a) full-length human protein.
  • Sequence:
  • MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLG
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • MLST8 MaxPab rabbit polyclonal antibody. Western Blot analysis of MLST8 expression in mouse liver.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MLST8 expression in transfected 293T cell line (H00064223-T02) by MLST8 MaxPab polyclonal antibody.

    Lane 1: MLST8 transfected lysate(35.90 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of MLST8 transfected lysate using anti-MLST8 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MLST8 MaxPab mouse polyclonal antibody (B01) (H00064223-B01).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • MLST8
  • Gene Alias:
  • GBL,LST8,POP3,WAT1,GbetaL
  • Gene Description:
  • MTOR associated protein, LST8 homolog (S. cerevisiae)
  • Other Designations:
  • OTTHUMP00000159046
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook