Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SEMA4A (Human) Recombinant Protein (Q01)

  • Catalog # : H00064218-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SEMA4A partial ORF ( NP_071762, 33 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • GGGQGPMPRVRYYAGDERRALSFFHQKGLQDFDTLLLSGDGNTLYVGAREAILALDIQDPGVPRLKNMIPWPASDRKKSECAFKKKSNETQCFNFIRVLV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00064218-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • SEMA4A
  • Gene Alias:
  • CORD10,FLJ12287,RP35,SEMAB,SEMB
  • Gene Description:
  • sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A
  • Gene Summary:
  • SEMA4A is a member of the semaphorin family of soluble and transmembrane proteins. Semaphorins are involved in guidance of axonal migration during neuronal development and in immune responses.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000015916,OTTHUMP00000015917,OTTHUMP00000015918,sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, 4A,semaphorin B
  • Gene Pathway
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook