IFIH1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human IFIH1 protein.
Immunogen
IFIH1 (AAH46208.1, 1 a.a. ~ 221 a.a) full-length human protein.
Sequence
MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSESNAGICNFTEEDSSNSA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (67); Rat (69)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of IFIH1 expression in transfected 293T cell line (H00064135-T01) by IFIH1 MaxPab polyclonal antibody.
Lane 1: IFIH1 transfected lysate(24.31 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — IFIH1
Entrez GeneID
64135GeneBank Accession#
BC046208.1Protein Accession#
AAH46208.1Gene Name
IFIH1
Gene Alias
Hlcd, IDDM19, MDA-5, MDA5, MGC133047
Gene Description
interferon induced with helicase C domain 1
Gene Ontology
HyperlinkGene Summary
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein that is upregulated in response to treatment with beta-interferon (IFNB) and a protein kinase C-activating compound, mezerein (MEZ). Irreversible reprogramming of melanomas can be achieved by treatment with both these agents; treatment with either agent alone only achieves reversible differentiation. [provided by RefSeq
Other Designations
DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide|helicard|melanoma differentiation associated protein-5
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com