SLC39A8 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SLC39A8 partial ORF ( NP_071437.3, 217 a.a. - 296 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
KMLLKTYGQNGHTHFGNDNFGPQEKTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCLKGPK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
34.54
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SLC39A8
Entrez GeneID
64116GeneBank Accession#
NM_022154Protein Accession#
NP_071437.3Gene Name
SLC39A8
Gene Alias
BIGM103, LZT-Hs6, PP3105, ZIP8
Gene Description
solute carrier family 39 (zinc transporter), member 8
Omim ID
608732Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the SLC39 family of solute-carrier genes, which show structural characteristics of zinc transporters. The encoded protein is glycosylated and found in the plasma membrane and mitochondria, and functions in the cellular import of zinc at the onset of inflammation. It is also thought to be the primary transporter of the toxic cation cadmium, which is found in cigarette smoke. Multiple transcript variants encoding different isoforms have been found for this gene. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq
Other Designations
BCG induced integral membrane protein BIGM103|LIV-1 subfamily of ZIP zinc transporter 6|Zrt- and Irt-like protein 8|solute carrier family 39 (metal ion transporter), member 8|zinc transporter ZIP8
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com