MCCC2 monoclonal antibody (M05), clone 2B3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MCCC2 expression in transfected 293T cell line by MCCC2 monoclonal antibody (M05), clone 2B3.
Lane 1: MCCC2 transfected lysate (Predicted MW: 61.3 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MCCC2 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MCCC2 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.62 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MCCC2.
Immunogen
MCCC2 (NP_071415, 456 a.a. ~ 563 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AYSPRFLYIWPNARISVMGGEQAANVLATITKDQRAREGKQFSSADEAALKEPIIKKFEEEGNPYYSSARVWDDGIIDPADTRLVLGLSFSAALNAPIEKTDFGIFRM
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (88)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MCCC2 expression in transfected 293T cell line by MCCC2 monoclonal antibody (M05), clone 2B3.
Lane 1: MCCC2 transfected lysate (Predicted MW: 61.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MCCC2 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MCCC2 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — MCCC2
Entrez GeneID
64087GeneBank Accession#
NM_022132Protein Accession#
NP_071415Gene Name
MCCC2
Gene Alias
MCCB
Gene Description
methylcrotonoyl-Coenzyme A carboxylase 2 (beta)
Gene Ontology
HyperlinkGene Summary
This gene encodes the small subunit of 3-methylcrotonyl-CoA carboxylase. This enzyme functions as a heterodimer and catalyzes the carboxylation of 3-methylcrotonyl-CoA to form 3-methylglutaconyl-CoA. Mutations in this gene are associated with 3-Methylcrotonylglycinuria, an autosomal recessive disorder of leucine catabolism. [provided by RefSeq
Other Designations
biotin carboxylase|non-biotin containing subunit of 3-methylcrotonyl-CoA carboxylase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com