Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GOLPH3 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00064083-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human GOLPH3 protein.
  • Immunogen:
  • GOLPH3 (NP_071413.1, 1 a.a. ~ 298 a.a) full-length human protein.
  • Sequence:
  • MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of GOLPH3 expression in transfected 293T cell line (H00064083-T02) by GOLPH3 MaxPab polyclonal antibody.

    Lane 1: GOLPH3 transfected lysate(32.78 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • GOLPH3
  • Gene Alias:
  • FLJ90675,GOPP1,GPP34,MIDAS
  • Gene Description:
  • golgi phosphoprotein 3 (coat-protein)
  • Gene Summary:
  • The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a peripheral membrane protein of the Golgi stack and may have a regulatory role in Golgi trafficking. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000115847,coat-protein,golgi peripheral membrane protein 1, 34 kDa,golgi phosphoprotein 3,golgi protein,golgi-associated protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook