CDH23 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CDH23 partial ORF ( NP_071407, 29 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
PFFTNHFFDTYLLISEDTPVGSSVTQLLAQDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVI
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.2
Interspecies Antigen Sequence
Mouse (95); Rat (96)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CDH23
Entrez GeneID
64072GeneBank Accession#
NM_022124Protein Accession#
NP_071407Gene Name
CDH23
Gene Alias
DFNB12, DKFZp434P2350, FLJ00233, FLJ36499, KIAA1774, KIAA1812, MGC102761, USH1D
Gene Description
cadherin-like 23
Gene Ontology
HyperlinkGene Summary
This gene is a member of the cadherin superfamily, whose genes encode calcium dependent cell-cell adhesion glycoproteins. The encoded protein is a large, single-pass transmembrane protein composed of an extracellular domain containing 27 repeats that show significant homology to the cadherin ectodomain. Expressed in the neurosensory epithelium, the protein is thought to be involved in stereocilia organization and hair bundle formation. The gene is located in a region containing the human deafness loci DFNB12 and USH1D. Usher syndrome 1D and nonsyndromic autosomal recessive deafness DFNB12 are caused by allelic mutations of this cadherin-like gene. Two alternative splice variants have been identified that encode different isoforms. Additional variants have been observed but their full-length nature has not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000044780|cadherin 23|cadherin related 23|cadherin-23|otocadherin
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com