APBA2BP MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse polyclonal antibody raised against a full-length human APBA2BP protein.
Immunogen
APBA2BP (AAH47673.1, 1 a.a. ~ 362 a.a) full-length human protein.
Sequence
MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVLSLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQFVTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQVNRLQELIDQLECKAPRLEPLREEDLAKGPDLHILMAQRQVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNNN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (84)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NECAB3 expression in transfected 293T cell line (H00063941-T01) by NECAB3 MaxPab polyclonal antibody.
Lane 1: APBA2BP transfected lysate(39.82 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — NECAB3
Entrez GeneID
63941GeneBank Accession#
BC047673.1Protein Accession#
AAH47673.1Gene Name
NECAB3
Gene Alias
APBA2BP, EFCBP3, NIP1, STIP3, SYTIP2, XB51, dJ63M2.4, dJ63M2.5
Gene Description
N-terminal EF-hand calcium binding protein 3
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
EF-hand calcium binding protein 3|Nek2-interacting protein 1|OTTHUMP00000030659|OTTHUMP00000035342|X11L-binding protein 51|amyloid beta (A4) precursor protein-binding, family A, member 2 binding protein|neuronal calcium-binding protein NECAB3|synaptotagmi
-
Interactomes
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com