CIDEC purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CIDEC protein.
Immunogen
CIDEC (AAH16851, 1 a.a. ~ 238 a.a) full-length human protein.
Sequence
MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVARVTFDLYKLNPQDFIGRLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWALFSMQATGHVLLGTSCYLQQLLDATEEGQPPKGKASSLIPTCLKILQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (79); Rat (79)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CIDEC expression in transfected 293T cell line (H00063924-T01) by CIDEC MaxPab polyclonal antibody.
Lane 1: CIDEC transfected lysate(26.29 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CIDEC
Entrez GeneID
63924GeneBank Accession#
BC016851Protein Accession#
AAH16851Gene Name
CIDEC
Gene Alias
CIDE-3, FLJ20871, Fsp27
Gene Description
cell death-inducing DFFA-like effector c
Gene Ontology
HyperlinkGene Summary
DNA fragmentation factor (DFF) induces the fragmentation of DNA associated with apoptosis. A novel family of cell death-inducing DFF45 (MIM 601882)-like effectors (CIDEs), including CIDEC, can also promote apoptosis (Liang et al., 2003 [PubMed 12429024]).[supplied by OMIM
Other Designations
cell death activator CIDE-3|fat specific protein 27
-
Interactome
-
Publication Reference
-
Differential regulation of CIDEA and CIDEC expression by insulin via Akt1/2- and JNK2-dependent pathways in human adipocytes.
Ito M, Nagasawa M, Omae N, Ide T, Akasaka Y, Murakami K.
Journal of Lipid Research 2011 Aug; 52(8):1450.
Application:WB-Tr, Human, Human adipocytes.
-
Differential roles of CIDEA and CIDEC in insulin-induced anti-apoptosis and lipid droplet formation in human adipocytes.
Ito M, Nagasawa M, Hara T, Ide T, Murakami K.
Journal of Lipid Research 2010 Jul; 51(7):1676.
Application:WB, Human, Adipocytes.
-
Differential regulation of CIDEA and CIDEC expression by insulin via Akt1/2- and JNK2-dependent pathways in human adipocytes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com