Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DUSP21 (Human) Recombinant Protein (P01)

  • Catalog # : H00063904-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DUSP21 full-length ORF ( NP_071359.2, 1 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MTASASSFSSSQGVQQPSIYSFSQITRSLFLSNGVAANDKLLLSSNRITAIVNASVEVVNVFFEGIQYIKVPVTDARDSRLYDFFDPIADLIHTIDMRQGRTLLHCMAGVSRSASLCLAYLMKYHSMSLLDAHTWTKSRRPIIRPNNGFWEQLINYEFKLFNNNTVRMINSPVGNIPDIYEKDLRTMISM
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 47.9
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00063904-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • DUSP21
  • Gene Alias:
  • LMWDSP21,MGC149878
  • Gene Description:
  • dual specificity phosphatase 21
  • Gene Summary:
  • This gene encodes a member of the dual specificity phosphatase family, specifically the low molecular weight dual specificity phosphatase family. The encoded protein localizes to both the cytoplasm and the nucleus and functions to remove phosphate groups from phosphotyrosine and phosphothreonine residues
  • Other Designations:
  • low molecular weight dual specificity phosphatase 21
  • RSS
  • YouTube
  • Linkedin
  • Facebook