SMAP1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SMAP1 protein.
Immunogen
SMAP1 (NP_068759.2, 1 a.a. ~ 440 a.a) full-length human protein.
Sequence
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIRDKYEKKKYYDKNAIAITNKEKEKKKEEKKREKEPEKPAKPLTAEKLQKKDQQLEPKKSTSPKKAAEPTVDLLGLDGPAVAPVTNGNTTVPPLNDDLDIFGPMISNPLPATVMPPAQGTPSAPAAATLSTVTSGDLDLFTEQTTKSEEVAKKQLSKDSILSLYGTGTIQQQSTPGVFMGPTNIPFTSQAPAAFQGFPSMGVPVPAAPGLIGNVMGQSPSMMVGMPMPNGFMGNAQTGVMPLPQNVVGPQGGMVGQMGAPQSKFGLPQAQQPQWSLSQMNQQMAGMSISSATPTAGFGQPSSTTAGWSGSSSGQTLSTQLWK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SMAP1 MaxPab polyclonal antibody. Western Blot analysis of SMAP1 expression in K-562.Western Blot (Cell lysate)
SMAP1 MaxPab polyclonal antibody. Western Blot analysis of SMAP1 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of SMAP1 expression in transfected 293T cell line (H00060682-T01) by SMAP1 MaxPab polyclonal antibody.
Lane 1: SMAP1 transfected lysate(48.4 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SMAP1
Entrez GeneID
60682GeneBank Accession#
NM_021940.3Protein Accession#
NP_068759.2Gene Name
SMAP1
Gene Alias
FLJ13159, FLJ42245, SMAP-1
Gene Description
small ArfGAP 1
Omim ID
611372Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is similar to the mouse stromal membrane-associated protein-1. This similarity suggests that this human gene product is also a type II membrane glycoprotein involved in the erythropoietic stimulatory activity of stromal cells. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000016708|OTTHUMP00000016709|stromal membrane-associated GTPase-activating protein 1
-
Interactome
-
Pathway
-
Publication Reference
-
Pals1 functions in redundancy with SMAP1 to inhibit Arf6 in order to prevent Rac1-dependent colorectal cancer cell migration and invasion.
Julia Harms, Simona Mareike Lüttgenau, Christin Emming, Justine Guske, Katrin Weber, Thomas Wagner, Larissa Schowe, Pavel Nedvetsky, Michael P Krahn.
Cancer Gene Therapy 2023 Mar; 30(3):497.
Application:WB-Ce, Human, Caco-2, DLD1, HCT116, RKO, SW48 cells.
-
Pals1 functions in redundancy with SMAP1 to inhibit Arf6 in order to prevent Rac1-dependent colorectal cancer cell migration and invasion.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com