FKBP10 monoclonal antibody (M02), clone 3B5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FKBP10.
Immunogen
FKBP10 (NP_068758, 377 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (88)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.08 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FKBP10 monoclonal antibody (M02), clone 3B5. Western Blot analysis of FKBP10 expression in HepG2(Cat # L019V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FKBP10 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — FKBP10
Entrez GeneID
60681GeneBank Accession#
NM_021939Protein Accession#
NP_068758Gene Name
FKBP10
Gene Alias
FKBP6, FKBP65, FLJ20683, FLJ22041, FLJ23833, hFKBP65
Gene Description
FK506 binding protein 10, 65 kDa
Omim ID
607063Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase family. It is located in endoplasmic reticulum and acts as molecular chaperones. An alternatively spliced variant encoding different isoform has been found, but the biological validity of the variant is not determined. [provided by RefSeq
Other Designations
-
-
Interactome
-
Publication Reference
-
A novel splicing mutation in FKBP10 causing osteogenesis imperfecta with a possible mineralization defect.
Venturi G, Monti E, Carbonare LD, Corradi M, Gandini A, Valenti MT, Boner A, Antoniazzi F.
Bone 2012 Jan; 50(1):343.
Application:WB-Ce, Human, Human dermal fibroblasts.
-
A novel splicing mutation in FKBP10 causing osteogenesis imperfecta with a possible mineralization defect.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com