Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BRUNOL5 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00060680-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human BRUNOL5 protein.
  • Immunogen:
  • BRUNOL5 (AAH47522, 1 a.a. ~ 402 a.a) full-length human protein.
  • Sequence:
  • MARLTESEARRQQQQLLQPRPSPVGSSGPEPPGGQPDGMKDLDAIKLFVGQIPRHLDEKDLKPLLEQFGRIYELTVLKDPYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSESRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQIGAVSLNGLPATPIAPASGLHSPPLLGTTAVPGLVAPITNGFAGVVPFSRWAPCPGNRLCQWPCALPSSEPDCGRDTASCLLRSPAVHSHVPHRGHHAHRAQRPPAAAPPAAAAARRSLETRS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of BRUNOL5 expression in transfected 293T cell line (H00060680-T01) by BRUNOL5 MaxPab polyclonal antibody.

    Lane 1: BRUNOL5 transfected lysate(44.22 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • BRUNOL5
  • Gene Alias:
  • BRUNOL-5,CELF5
  • Gene Description:
  • bruno-like 5, RNA binding protein (Drosophila)
  • Gene Summary:
  • Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. [provided by RefSeq
  • Other Designations:
  • Bruno -like 5, RNA binding protein,CUG-BP and ETR-3 like factor 5,RNA-binding protein BRUNOL-5,bruno-like 5, RNA binding protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook