PROK2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (35.9 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PROK2.
Immunogen
PROK2 (NP_068754, 20 a.a. ~ 108 a.a) partial recombinant protein with GST tag.
Sequence
LTPRAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (76); Rat (76)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.9 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — PROK2
Entrez GeneID
60675GeneBank Accession#
NM_021935Protein Accession#
NP_068754Gene Name
PROK2
Gene Alias
BV8, KAL4, MIT1, PK2
Gene Description
prokineticin 2
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein expressed in the suprachiasmatic nucleus (SCN) circadian clock that may function as the output component of the circadian clock. The secreted form of the encoded protein may also serve as a chemoattractant for neuronal precursor cells in the olfactory bulb. Proteins from other vertebrates which are similar to this gene product were isolated based on homology to snake venom and secretions from frog skin, and have been shown to have diverse functions. Mutations in this gene are associated with Kallmann syndrome 4. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
protein Bv8 homolog
-
Interactome
-
Disease
-
Publication Reference
-
Abnormalities of neurotransmitter and neuropeptide systems in human neuroepithelioma cells infected by three Toxoplasma strains.
Xiao J, Li Y, Jones-Brando L, Yolken RH.
Journal of Neural Transmission 2013 Dec; 120(12):1631.
Application：WB-Ce, Human, SK-N-MC cells.
-
The prokineticin receptor-1 (GPR73) promotes cardiomyocyte survival and angiogenesis.
Urayama K, Guilini C, Messaddeq N, Hu K, Steenman M, Kurose H, Ert G, Nebigil CG.
FASEB Journal 2007 Apr; 21(11):2980.
Application：IHC, Human, Hearts from patients with end-stage heart failure who underwent a cardiac transplantation.
-
Abnormalities of neurotransmitter and neuropeptide systems in human neuroepithelioma cells infected by three Toxoplasma strains.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com