Product Browser

Last updated: 2017/11/12

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AASDHPPT polyclonal antibody (A01)

  • Catalog # : H00060496-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant AASDHPPT.
  • Immunogen:
  • AASDHPPT (NP_056238, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00060496-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • AASDHPPT polyclonal antibody (A01), Lot # 060125JC01 Western Blot analysis of AASDHPPT expression in SJCRH30 ( Cat # L027V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • AASDHPPT
  • Gene Alias:
  • AASD-PPT,CGI-80,DKFZp566E2346,LYS2,LYS5
  • Gene Description:
  • aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
  • Gene Summary:
  • The protein encoded by this gene is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia. [provided by RefSeq
  • Other Designations:
  • 4'-phosphopantetheinyl transferase,alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase
  • RSS
  • YouTube
  • Linkedin
  • Facebook