Product Browser

Last updated: 2017/4/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

APOBEC3G polyclonal antibody (A01)

  • Catalog # : H00060489-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant APOBEC3G.
  • Immunogen:
  • APOBEC3G (NP_068594, 80 a.a. ~ 181 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LHRDQEYEVTWYISWSPCTKCTRDMATFLAEDPKVTLTIFVARLYYFWDPDYQEALRSLCQKRDGPRATMKIMNYDEFQHCWSKFVYSQRELFEPWNNLPKY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00060489-A01
    Western Blot detection against Immunogen (37.33 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • APOBEC3G
  • Gene Alias:
  • ARP9,CEM15,FLJ12740,MDS019,bK150C2.7,dJ494G10.1
  • Gene Description:
  • apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G
  • Gene Summary:
  • This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. The protein encoded by this gene has been found to be a specific inhibitor of human immunodeficiency virus-1 (HIV-1) infectivity. [provided by RefSeq
  • Other Designations:
  • DNA dC->dU editing enzyme,OTTHUMP00000028911,phorbolin-like protein MDS019
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook