MRPS35 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MRPS35 protein.
Immunogen
MRPS35 (NP_068593.2, 1 a.a. ~ 323 a.a) full-length human protein.
Sequence
MAAAALPAWLSLQSRARTLRAFSTAVYSATPVPTPSLPERTPGNERPPRRKALPPRTEKMAVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKTTDVLTIKTDRCPLRRQNYDYAVYLLTVLYHESWNTEEWEKSKTEADMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVKRLLNVT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (76); Rat (77)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MRPS35 MaxPab polyclonal antibody. Western Blot analysis of MRPS35 expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of MRPS35 expression in transfected 293T cell line (H00060488-T02) by MRPS35 MaxPab polyclonal antibody.
Lane 1: MRPS35 transfected lysate(35.53 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MRPS35
Entrez GeneID
60488GeneBank Accession#
NM_021821Protein Accession#
NP_068593.2Gene Name
MRPS35
Gene Alias
DKFZp762P093, HDCMD11P, MDS023, MGC104278, MRP-S28, MRPS28
Gene Description
mitochondrial ribosomal protein S35
Gene Ontology
HyperlinkGene Summary
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that has had confusing nomenclature in the literature. Pseudogenes corresponding to this gene are found on chromosomes 3p, 5q, and 10q. [provided by RefSeq
Other Designations
mitochondrial ribosomal protein S28
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com