TGIF2 monoclonal antibody (M01), clone 4C10

Catalog # H00060436-M01

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

TGIF2 monoclonal antibody (M01), clone 4C10 Western Blot analysis of TGIF2 expression in Hela S3 NE ( Cat # L013V3 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

TGIF2 monoclonal antibody (M01), clone 4C10. Western Blot analysis of TGIF2 expression in IMR-32 ( Cat # L008V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

TGIF2 monoclonal antibody (M01), clone 4C10. Western Blot analysis of TGIF2 expression in SW-13 ( Cat # L005V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

TGIF2 monoclonal antibody (M01), clone 4C10. Western Blot analysis of TGIF2 expression in Y-79 ( Cat # L042V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

TGIF2 monoclonal antibody (M01), clone 4C10. Western Blot analysis of TGIF2 expression in A-431 ( Cat # L015V1 ).

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of TGIF2 expression in transfected 293T cell line by TGIF2 monoclonal antibody (M01), clone 4C10.

Lane 1: TGIF2 transfected lysate(25.9 KDa).
Lane 2: Non-transfected lysate.

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged TGIF2 is approximately 0.3ng/ml as a capture antibody.

RNAi Knockdown (Antibody validated)
Application

RNAi Knockdown (Antibody validated)

Western blot analysis of TGIF2 over-expressed 293 cell line, cotransfected with TGIF2 Validated Chimera RNAi ( Cat # H00060436-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TGIF2 monoclonal antibody (M01), clone 4C10 (Cat # H00060436-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

QC Test

Western Blot detection against Immunogen (37.4 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant TGIF2.

    Immunogen

    TGIF2 (NP_068581, 131 a.a. ~ 236 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    SMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENP

    Host

    Mouse

    Reactivity

    Human

    Interspecies Antigen Sequence

    Mouse (94); Rat (95)

    Isotype

    IgG2a Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (37.4 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    TGIF2 monoclonal antibody (M01), clone 4C10 Western Blot analysis of TGIF2 expression in Hela S3 NE ( Cat # L013V3 ).

    Western Blot (Cell lysate)

    TGIF2 monoclonal antibody (M01), clone 4C10. Western Blot analysis of TGIF2 expression in IMR-32 ( Cat # L008V1 ).

    Western Blot (Cell lysate)

    TGIF2 monoclonal antibody (M01), clone 4C10. Western Blot analysis of TGIF2 expression in SW-13 ( Cat # L005V1 ).

    Western Blot (Cell lysate)

    TGIF2 monoclonal antibody (M01), clone 4C10. Western Blot analysis of TGIF2 expression in Y-79 ( Cat # L042V1 ).

    Western Blot (Cell lysate)

    TGIF2 monoclonal antibody (M01), clone 4C10. Western Blot analysis of TGIF2 expression in A-431 ( Cat # L015V1 ).

    Western Blot (Transfected lysate)

    Western Blot analysis of TGIF2 expression in transfected 293T cell line by TGIF2 monoclonal antibody (M01), clone 4C10.

    Lane 1: TGIF2 transfected lysate(25.9 KDa).
    Lane 2: Non-transfected lysate.

    Western Blot (Recombinant protein)

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged TGIF2 is approximately 0.3ng/ml as a capture antibody.

    ELISA

    RNAi Knockdown (Antibody validated)

    Western blot analysis of TGIF2 over-expressed 293 cell line, cotransfected with TGIF2 Validated Chimera RNAi ( Cat # H00060436-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TGIF2 monoclonal antibody (M01), clone 4C10 (Cat # H00060436-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • Gene Info — TGIF2

    Entrez GeneID

    60436

    GeneBank Accession#

    NM_021809

    Protein Accession#

    NP_068581

    Gene Name

    TGIF2

    Gene Alias

    -

    Gene Description

    TGFB-induced factor homeobox 2

    Omim ID

    607294

    Gene Ontology

    Hyperlink

    Gene Summary

    The protein encoded by this gene is a DNA-binding homeobox protein and a transcriptional repressor. The encoded protein appears to repress transcription by recruiting histone deacetylases to TGF beta-responsive genes. This gene is amplified and overexpressed in some ovarian cancers, and mutations in this gene can cause holoprosencephaly. [provided by RefSeq

    Other Designations

    5'-TG-3' interacting factor 2|OTTHUMP00000030848|OTTHUMP00000030849|TGF(beta)-induced transcription factor 2|TGFB-induced factor 2 (TALE family homeobox)|homeobox protein TGIF2|transcription growth factor-beta-induced factor 2

  • Interactome
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All