TGIF2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human TGIF2 protein.
Immunogen
TGIF2 (NP_068581.1, 1 a.a. ~ 237 a.a) full-length human protein.
Sequence
MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (95)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TGIF2 expression in transfected 293T cell line (H00060436-T01) by TGIF2 MaxPab polyclonal antibody.
Lane 1: TGIF2 transfected lysate(25.90 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TGIF2
Entrez GeneID
60436GeneBank Accession#
NM_021809.4Protein Accession#
NP_068581.1Gene Name
TGIF2
Gene Alias
-
Gene Description
TGFB-induced factor homeobox 2
Omim ID
607294Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a DNA-binding homeobox protein and a transcriptional repressor. The encoded protein appears to repress transcription by recruiting histone deacetylases to TGF beta-responsive genes. This gene is amplified and overexpressed in some ovarian cancers, and mutations in this gene can cause holoprosencephaly. [provided by RefSeq
Other Designations
5'-TG-3' interacting factor 2|OTTHUMP00000030848|OTTHUMP00000030849|TGF(beta)-induced transcription factor 2|TGFB-induced factor 2 (TALE family homeobox)|homeobox protein TGIF2|transcription growth factor-beta-induced factor 2
-
Interactome
-
Publication Reference
-
Differential roles of TGIF family genes in mammalian reproduction.
Hu Y, Yu H, Shaw G, Renfree MB, Pask AJ.
BMC Developmental Biology 2011 Sep; 11:58.
Application:IHC-P, Tammar, Tammar adult testis.
-
Differential roles of TGIF family genes in mammalian reproduction.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com