Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

  • By Pathway

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TGIF2 polyclonal antibody (A01)

  • Catalog # : H00060436-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TGIF2.
  • Immunogen:
  • TGIF2 (NP_068581, 131 a.a. ~ 236 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00060436-A01
    Western Blot detection against Immunogen (37.77 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • TGIF2
  • Gene Alias:
  • -
  • Gene Description:
  • TGFB-induced factor homeobox 2
  • Gene Summary:
  • The protein encoded by this gene is a DNA-binding homeobox protein and a transcriptional repressor. The encoded protein appears to repress transcription by recruiting histone deacetylases to TGF beta-responsive genes. This gene is amplified and overexpressed in some ovarian cancers, and mutations in this gene can cause holoprosencephaly. [provided by RefSeq
  • Other Designations:
  • 5'-TG-3' interacting factor 2,OTTHUMP00000030848,OTTHUMP00000030849,TGF(beta)-induced transcription factor 2,TGFB-induced factor 2 (TALE family homeobox),homeobox protein TGIF2,transcription growth factor-beta-induced factor 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook