EXOC4 monoclonal antibody (M06), clone 4F1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EXOC4.
Immunogen
EXOC4 (NP_068579, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEAYEKCDRDLDELIVQHYTELTTAIRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKRD
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EXOC4 monoclonal antibody (M06), clone 4F1. Western Blot analysis of EXOC4 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
EXOC4 monoclonal antibody (M06), clone 4F1. Western Blot analysis of EXOC4 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
EXOC4 monoclonal antibody (M06), clone 4F1 Western Blot analysis of EXOC4 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
EXOC4 monoclonal antibody (M06), clone 4F1. Western Blot analysis of EXOC4 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EXOC4 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — EXOC4
Entrez GeneID
60412GeneBank Accession#
NM_021807Protein Accession#
NP_068579Gene Name
EXOC4
Gene Alias
MGC27170, REC8, SEC8, SEC8L1, Sec8p
Gene Description
exocyst complex component 4
Omim ID
608185Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
SEC8 protein|SEC8-like 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Exocyst subunits are involved in isoproterenol-induced amylase release from rat parotid acinar cells.
Imai A, Yoshie S, Haga-Tsujimura M, Nashida T, Shimomura H.
European Journal of Oral Sciences 2012 Apr; 120(2):123.
Application:IF, IP, WB-Ce, WB-Ti, Rat, Brains, Kidneys, Parotid glands, Rat parotid acinar cells.
-
Exocyst subunits are involved in isoproterenol-induced amylase release from rat parotid acinar cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com