EDA2R purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human EDA2R protein.
Immunogen
EDA2R (NP_068555.1, 1 a.a. ~ 297 a.a) full-length human protein.
Sequence
MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAFQLSLVEADAPTVPPQEATLVALVSSLLVVFTLAFLGLFFLYCKQFFNRHCQRGGLLQFEADKTAKEESLFPVPPSKETSAESQVSENIFQTQPLNPILEDDCSSTSGFPTQESFTMASCTSESHSHWVHSPIECTELDLQKFSSSASYTGAETLGGNTVESTGDRLELNVPFEVPSP
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
EDA2R MaxPab rabbit polyclonal antibody. Western Blot analysis of EDA2R expression in mouse liver.Western Blot (Transfected lysate)
Western Blot analysis of EDA2R expression in transfected 293T cell line (H00060401-T02) by EDA2R MaxPab polyclonal antibody.
Lane 1: EDA2R transfected lysate(32.70 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — EDA2R
Entrez GeneID
60401GeneBank Accession#
NM_021783Protein Accession#
NP_068555.1Gene Name
EDA2R
Gene Alias
EDA-A2R, EDAA2R, TNFRSF27, XEDAR
Gene Description
ectodysplasin A2 receptor
Omim ID
300276Gene Ontology
HyperlinkGene Summary
EDA-A1 and EDA-A2 are two isoforms of ectodysplasin that are encoded by the anhidrotic ectodermal dysplasia (EDA) gene. Mutations in EDA give rise to a clinical syndrome characterized by loss of hair, sweat glands, and teeth. The protein encoded by this gene specifically binds to EDA-A2 isoform. This protein is a type III transmembrane protein of the TNFR (tumor necrosis factor receptor) superfamily, and contains 3 cysteine-rich repeats and a single transmembrane domain but lacks an N-terminal signal peptide. Multiple alternatively spliced transcript variants have been found for this gene, but some variants lack sufficient support. [provided by RefSeq
Other Designations
EDA-A2 receptor|OTTHUMP00000023448|X-linked ectodysplasin receptor|X-linked ectodysplasin-A2 receptor|tumor necrosis factor receptor superfamily member XEDAR
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Rescue of gene-expression changes in an induced mouse model of spinal muscular atrophy by an antisense oligonucleotide that promotes inclusion of SMN2 exon 7.
Staropoli JF, Li H, Chun SJ, Allaire N, Cullen P, Thai A, Fleet CM, Hua Y, Bennett CF, Krainer AR, Kerr D, McCampbell A, Rigo F, Carulli JP.
Genomics 2015 Apr; 105(4):220.
Application:WB, Mouse, Spinal cord.
-
Rescue of gene-expression changes in an induced mouse model of spinal muscular atrophy by an antisense oligonucleotide that promotes inclusion of SMN2 exon 7.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com