LGR7 monoclonal antibody (M01), clone 3E3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LGR7.
Immunogen
LGR7 (NP_067647, 68 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
WSMQFDKYFASYYKMTSQYPFEAETPECLVGSVPVQCLCQGLELDCDETNLRAVPSVSSNVTAMSLQWNLIRKLPPDCFKNYHDLQKLYLQNNKI
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.19 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LGR7 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — RXFP1
Entrez GeneID
59350GeneBank Accession#
NM_021634Protein Accession#
NP_067647Gene Name
RXFP1
Gene Alias
LGR7, LGR7.1, LGR7.10, LGR7.2, MGC138347, MGC142177, RXFPR1
Gene Description
relaxin/insulin-like family peptide receptor 1
Omim ID
606654Gene Ontology
HyperlinkOther Designations
leucine-rich repeat-containing G protein-coupled receptor 7|relaxin family peptide receptor 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
C1q/TNF-Related Proteins 1, 6 and 8 Are Involved in Corneal Epithelial Wound Closure by Targeting Relaxin Receptor RXFP1 In Vitro.
Hagen Fabian Nicolaus, Thomas Klonisch, Friedrich Paulsen, Fabian Garreis.
International Journal of Molecular Sciences 2023 Apr; 24(7):6839.
Application:IHC-P, Human, HCE ccells.
-
The distribution of relaxin receptors in the anterior segment of primary open-angle glaucoma patients.
Ofira Zloto, Alon Skaat, Ido Didi Fabian, Mordechai Rosner, Hana Ziv, Ari Leshno, Shlomo Melamed.
Indian Journal of Ophthalmology 2020 Oct; 68(10):2117.
Application:IHC-P, Human, Patients with primary open‑angle glaucoma.
-
Serelaxin alleviates cardiac fibrosis through inhibiting endothelial-to-mesenchymal transition via RXFP1.
Tim Wilhelmi, Xingbo Xu, Xiaoying Tan, Melanie S Hulshoff, Sabine Maamari, Samuel Sossalla, Michael Zeisberg, Elisabeth M Zeisberg.
Theranostics 2020 Mar; 10(9):3905.
Application:WB-Tr, Human, Human coronary artery endothelial cells.
-
Localization of relaxin receptors in arteries and veins, and region-specific increases in compliance and bradykinin-mediated relaxation after in vivo serelaxin treatment.
Jelinic M, Leo CH, Uiterweer ED, Sandow SL, Gooi JH, Wlodek ME, Conrad KP, Parkington H, Tare M, Parry LJ.
FASEB Journal 2014 Jan; 28(1):275.
Application:IHC, Human, Arteries.
-
Relaxin regulates hyaluronan synthesis and aquaporins in the cervix of late pregnant mice.
Soh YM, Tiwari A, Mahendroo M, Conrad KP, Parry LJ.
Endocrinology 2012 Dec; 153(12):6054.
Application:IHC-P, Mouse, Mouse Cervix samples.
-
Effect of Relaxin on Human Sperm Functions and Fertilizing Ability.
Ferlin A, Menegazzo M, Gianesello L, Selice R, Foresta C.
Journal of Andrology 2012 May; 33(3):474.
Application:Func, IF, Human, HEK 293T cells, Human sperm.
-
Primate preimplantation embryo is a target for relaxin during early pregnancy.
Vandevoort CA, Mtango NR, Latham KE, Stewart DR.
Fertil Steril 2011 Jun; 96:203.
Application:IF, Monkey, Embryos.
-
Suppression of Relaxin Receptor RXFP1 Decreases Prostate Cancer Growth and Metastasis.
Feng S, Agoulnik I, Truong A, Li Z, Creighton CJ, Kaftanovskaya EM, Pereira R, Han HD, Lopez-Berestein G, Klonisch T, Ittmann M, Sood A, Agoulnik A.
Endocrine-Related Cancer 2010 Oct; 17(4):1021.
Application:IHC-P, Human, Mouse, LNCaP, Mouse xenograft tumors.
-
Decreased Expression of the Rat Myometrial Relaxin Receptor (RXFP1) in Late Pregnancy Is Partially Mediated by the Presence of the Conceptus.
Vodstrcil LA, Shynlova O, Verlander JW, Wlodek ME, Parry LJ.
Biology of Reproduction 2010 Nov; 83(5):818.
Application:IF, WB-Ce, Human, Mouse, In reference paper: HEK 293 cells, Mouse cervix membranes.
-
Relaxin stimulates osteoclast differentiation and activation.
Ferlin A, Pepe A, Facciolli A, Gianesello L, Foresta C.
Bone 2010 Feb; 46(2):504.
Application:IF, Human, Human osteoclasts, PBMCs.
-
Characterization of relaxin receptor (RXFP1) desensitization and internalization in primary human decidual cells and RXFP1 transfected HEK293 cells.
Kern A, Bryant-Greenwood GD.
Endocrinology 2009 May; 150(5):2419.
Application:WB, ICC, Flow Cyt, Human, Decidual cells, HEK 293 cells.
-
C1q/TNF-Related Proteins 1, 6 and 8 Are Involved in Corneal Epithelial Wound Closure by Targeting Relaxin Receptor RXFP1 In Vitro.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com