CACNG7 monoclonal antibody (M01), clone 1F7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CACNG7 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (33.66 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CACNG7.
Immunogen
CACNG7 (NP_114102.2, 203 a.a. ~ 274 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRGRSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSP
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.66 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CACNG7 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — CACNG7
Entrez GeneID
59284GeneBank Accession#
NM_031896Protein Accession#
NP_114102.2Gene Name
CACNG7
Gene Alias
-
Gene Description
calcium channel, voltage-dependent, gamma subunit 7
Omim ID
606899Gene Ontology
HyperlinkGene Summary
The mouse protein stargazin is one of five subunits comprising neuronal voltage-gated calcium channels. This subunit, gamma, is thought to stabilize the calcium channel in an inactive (closed) state. Mutations in the gene encoding stargazin have been associated with absence seizures, also known as petit-mal or spike-wave seizures. The protein encoded by this gene is structurally similar to the mouse stargazin protein and is a member of the neuronal calcium channel gamma subunit protein family. However, it appears unlikely that the encoded protein is part of a functional calcium channel. Rather, it appears to inhibit the expression of a specific calcium channel subunit. [provided by RefSeq
Other Designations
OTTHUMP00000067298|neuronal voltage-gated calcium channel gamma-7 subunit|voltage-dependent calcium channel gamma-7 subunit
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com