ACE2 (Human) Recombinant Protein (Q02)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ACE2 partial ORF (NP_068576.1, 23 a.a. - 52 a.a.) recombinant protein with GST tag at N-terminal.
Sequence
EQAKTFLDKFNHEAEDLFYQSSLASWNYNT
Theoretical MW (kDa)
28.93
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ACE2
Entrez GeneID
59272GeneBank Accession#
NM_021804.1Protein Accession#
NP_068576.1Gene Name
ACE2
Gene Alias
ACEH, DKFZp434A014
Gene Description
angiotensin I converting enzyme (peptidyl-dipeptidase A) 2
Omim ID
300335Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This secreted protein catalyzes the cleavage of angiotensin I into angiotensin 1-9, and angiotensin II into the vasodilator angiotensin 1-7. The organ- and cell-specific expression of this gene suggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. In addition, the encoded protein is a functional receptor for the spike glycoprotein of the human coronaviruses SARS and HCoV-NL63. [provided by RefSeq
Other Designations
ACE-related carboxypeptidase|OTTHUMP00000022963|angiotensin I converting enzyme 2|angiotensin converting enzyme-like protein
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com