Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MYOZ1 monoclonal antibody (M05A), clone 1E8

  • Catalog # : H00058529-M05A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant MYOZ1.
  • Immunogen:
  • MYOZ1 (NP_067068.1, 200 a.a. ~ 298 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MELGIDLLAYGAKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGEPVDYNVDIGIPLDGETEE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00058529-M05A
    Western Blot detection against Immunogen (36.63 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • MYOZ1 monoclonal antibody (M05A), clone 1E8. Western Blot analysis of MYOZ1 expression in HepG2. (34-kDa,http://www.ncbi.nlm.nih.gov/entrez/dispomim.cgi?id=605603)
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • MYOZ1
  • Gene Alias:
  • CS-2,FATZ,MYOZ
  • Gene Description:
  • myozenin 1
  • Other Designations:
  • OTTHUMP00000019817,calsarcin-2
  • RSS
  • YouTube
  • Linkedin
  • Facebook