Product Browser

Last updated: 2017/7/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CARD12 polyclonal antibody (A01)

  • Catalog # : H00058484-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CARD12.
  • Immunogen:
  • CARD12 (AAH31555, 531 a.a. ~ 630 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • QESLQSVKNTTEQEILKAININSFVECGIHLYQESTSKSALSQEFEAFFQGKSLYINSGNIPDYLFDFFEHLPNCASALDFIKLDFYGGAMASWEKAAED
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00058484-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • NLRC4
  • Gene Alias:
  • CARD12,CLAN,CLAN1,CLANA,CLANB,CLANC,CLAND,CLR2.1,IPAF
  • Gene Description:
  • NLR family, CARD domain containing 4
  • Gene Summary:
  • In C. elegans, Ced4 binds and activates Ced3, an apoptotic initiator caspase, via caspase-associated recruitment domains (CARDs). Human Ced4 homologs include APAF1 (MIM 602233), NOD1/CARD4 (MIM 605980), and NOD2/CARD15 (MIM 605956). These proteins have at least 1 N-terminal CARD domain followed by a centrally located nucleotide-binding domain (NBD or NACHT) and a C-terminal regulatory domain, found only in mammals, that contains either WD40 repeats or leucine-rich repeats (LRRs). CARD12 is a member of the Ced4 family and can induce apoptosis.[supplied by OMIM
  • Other Designations:
  • ICE-protease activating factor,NOD-like receptor C4,caspase recruitment domain family, member 12,caspase recruitment domain protein 12,nucleotide-binding oligomerization domain, leucine rich repeat and CARD domain containing 4
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook