Product Browser

Last updated: 2017/2/19
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ENOPH1 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00058478-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human ENOPH1 protein.
  • Immunogen:
  • ENOPH1 (NP_067027.1, 1 a.a. ~ 261 a.a) full-length human protein.
  • Sequence:
  • MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • ENOPH1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ENOPH1 expression in human colon.
  • PDF DownloadProtocol Download
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • ENOPH1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ENOPH1 expression in mouse spleen.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ENOPH1 expression in transfected 293T cell line (H00058478-T02) by ENOPH1 MaxPab polyclonal antibody.

    Lane 1: ENOPH1 transfected lysate(28.90 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • ENOPH1
  • Gene Alias:
  • DKFZp586M0524,E1,FLJ12594,MASA,MST145
  • Gene Description:
  • enolase-phosphatase 1
  • Other Designations:
  • E-1 enzyme,Enolase-phosphatase E1,MSTP145 protein,acireductone synthase
  • RSS
  • YouTube
  • Linkedin
  • Facebook