Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MS4A7 (Human) Recombinant Protein (P01)

  • Catalog # : H00058475-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MS4A7 full-length ORF ( AAH20673, 1 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLISSLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 52.14
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00058475-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • MS4A7
  • Gene Alias:
  • 4SPAN2,CD20L4,CFFM4,MGC22368,MS4A8
  • Gene Description:
  • membrane-spanning 4-domains, subfamily A, member 7
  • Gene Summary:
  • This gene encodes a member of the membrane-spanning 4A gene family, members of which are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns in hematopoietic cells and nonlymphoid tissues. This family member is associated with mature cellular function in the monocytic lineage, and it may be a component of a receptor complex involved in signal transduction. This gene is localized to 11q12, in a cluster of other family members. At least four alternatively spliced transcript variants encoding two distinct isoforms have been observed. [provided by RefSeq
  • Other Designations:
  • CD20/Fc-epsilon-RI-beta family member 4,four-span transmembrane protein 2,high affinity immunoglobulin epsilon receptor beta subunit
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook