MS4A7 monoclonal antibody (M06), clone 2D3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant MS4A7.
Immunogen
MS4A7 (AAH20673, 1 a.a. ~ 240 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLISSLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (52.14 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MS4A7 expression in transfected 293T cell line by MS4A7 monoclonal antibody (M06), clone 2D3.
Lane 1: MS4A7 transfected lysate(26.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MS4A7 is approximately 1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of MS4A7 over-expressed 293 cell line, cotransfected with MS4A7 Validated Chimera RNAi ( Cat # H00058475-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MS4A7 monoclonal antibody (M06), clone 2D3 (Cat # H00058475-M06 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — MS4A7
Entrez GeneID
58475GeneBank Accession#
BC020673Protein Accession#
AAH20673Gene Name
MS4A7
Gene Alias
4SPAN2, CD20L4, CFFM4, MGC22368, MS4A8
Gene Description
membrane-spanning 4-domains, subfamily A, member 7
Omim ID
606502Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the membrane-spanning 4A gene family, members of which are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns in hematopoietic cells and nonlymphoid tissues. This family member is associated with mature cellular function in the monocytic lineage, and it may be a component of a receptor complex involved in signal transduction. This gene is localized to 11q12, in a cluster of other family members. At least four alternatively spliced transcript variants encoding two distinct isoforms have been observed. [provided by RefSeq
Other Designations
CD20/Fc-epsilon-RI-beta family member 4|four-span transmembrane protein 2|high affinity immunoglobulin epsilon receptor beta subunit
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com