Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LSM2 polyclonal antibody (A01)

  • Catalog # : H00057819-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant LSM2.
  • Immunogen:
  • LSM2 (NP_067000, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00057819-A01
    Western Blot detection against Immunogen (36.56 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • LSM2 polyclonal antibody (A01), Lot # 061130JCS1 Western Blot analysis of LSM2 expression in 293 ( Cat # L026V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • LSM2
  • Gene Alias:
  • C6orf28,G7b,YBL026W,snRNP
  • Gene Description:
  • LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae)
  • Gene Summary:
  • Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM
  • Other Designations:
  • LSM2 homolog, U6 small nuclear RNA associated,OTTHUMP00000029159,U6 snRNA-associated Sm-like protein
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook