Product Browser

Last updated: 2017/11/12
  • Related Product Showcase
  • By Disease

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HAMP polyclonal antibody (A01)

  • Catalog # : H00057817-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant HAMP.
  • Immunogen:
  • HAMP (AAH20612, 25 a.a. ~ 84 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00057817-A01
    Western Blot detection against Immunogen (32.71 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • HAMP
  • Gene Alias:
  • HEPC,HEPCIDIN,HFE2B,LEAP-1,LEAP1,PLTR
  • Gene Description:
  • hepcidin antimicrobial peptide
  • Gene Summary:
  • The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta-sheet structures. These peptides exhibit antimicrobial activity. Mutations in this gene cause hemochromatosis type 2B, also known as juvenile hemochromatosis, a disease caused by severe iron overload that results in cardiomyopathy, cirrhosis, and endocrine failure. [provided by RefSeq
  • Other Designations:
  • liver-expressed antimicrobial peptide,putative liver tumor regressor
  • RSS
  • YouTube
  • Linkedin
  • Facebook