Product Browser

Last updated: 2017/5/28
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

POLD4 monoclonal antibody (M10), clone 2C11

  • Catalog # : H00057804-M10
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant POLD4.
  • Immunogen:
  • POLD4 (AAH01334, 1 a.a. ~ 34 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00057804-M10
    Western Blot detection against Immunogen (29.48 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged POLD4 is approximately 1ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • POLD4
  • Gene Alias:
  • POLDS,p12
  • Gene Description:
  • polymerase (DNA-directed), delta 4
  • Gene Summary:
  • The DNA polymerase delta complex is involved in DNA replication and repair, and it consists of the proliferating cell nuclear antigen (PCNA; MIM 176740), the multisubunit replication factor C (see MIM 102579), and the 4 subunit polymerase complex: POLD1 (MIM 174761), POLD2 (MIM 600815), POLD3 (MIM 611415), and POLD4 (Liu and Warbrick, 2006 [PubMed 16934752]).[supplied by OMIM
  • Other Designations:
  • DNA polymerase delta smallest subunit p12
  • RSS
  • YouTube
  • Linkedin
  • Facebook