POLD4 monoclonal antibody (M01A), clone 2B11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant POLD4.
Immunogen
POLD4 (AAH01334, 1 a.a. ~ 34 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (82)
Isotype
IgG2b kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (29.48 KDa) .
Storage Buffer
In ascites fluid
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged POLD4 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — POLD4
Entrez GeneID
57804GeneBank Accession#
BC001334Protein Accession#
AAH01334Gene Name
POLD4
Gene Alias
POLDS, p12
Gene Description
polymerase (DNA-directed), delta 4
Omim ID
611525Gene Ontology
HyperlinkGene Summary
The DNA polymerase delta complex is involved in DNA replication and repair, and it consists of the proliferating cell nuclear antigen (PCNA; MIM 176740), the multisubunit replication factor C (see MIM 102579), and the 4 subunit polymerase complex: POLD1 (MIM 174761), POLD2 (MIM 600815), POLD3 (MIM 611415), and POLD4 (Liu and Warbrick, 2006 [PubMed 16934752]).[supplied by OMIM
Other Designations
DNA polymerase delta smallest subunit p12
-
Interactome
-
Pathway
-
Publication Reference
-
Replication stress activates DNA repair synthesis in mitosis.
Minocherhomji S, Ying S, Bjerregaard VA, Bursomanno S, Aleliunaite A, Wu W, Mankouri HW, Shen H, Liu Y, Hickson ID.
Nature 2015 Dec; 528(7581):286.
Application:WB, Human, HeLa, U2OS cells.
-
Regulation of DNA Polymerase POLD4 Influences Genomic Instability in Lung Cancer.
Huang QM, Tomida S, Masuda Y, Arima C, Cao K, Kasahara TA, Osada H, Yatabe Y, Akashi T, Kamiya K, Takahashi T, Suzuki M.
Cancer Research 2010 Nov; 70(21):8407.
Application:WB, Human, A-549, ACC-LC-48, ACC-LC-172, HCT-116, Human lung cancer cells.
-
Roles of POLD4, smallest subunit of DNA polymerase delta, in nuclear structures and genomic stability of human cells.
Huang QM, Akashi T, Masuda Y, Kamiya K, Takahashi T, Suzuki M.
Biochemical and Biophysical Research Communications 2009 Nov; 391(1):542.
Application:WB-Tr, Human, Calu6 cells.
-
A novel DNA damage response: Rapid degradation of the p12 subunit of DNA polymerase delta.
Zhang S, Zhou Y, Trusa S, Meng X, Lee EY, Lee MY.
The Journal of Biological Chemistry 2007 Feb; 282(21):15330.
Application:WB, Human, A549, H1299, HCT-116, HEK 293, HeLa cells.
-
Replication stress activates DNA repair synthesis in mitosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com