Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CHD8 monoclonal antibody (M11A), clone 2C8

  • Catalog # : H00057680-M11A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant CHD8.
  • Immunogen:
  • CHD8 (NP_065971.2, 1980 a.a. ~ 2078 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • EGLKLTFQKHKLMANGVMGDGHPLFHKKKGNRKKLVELEVECMEEPNHLDVDLETRIPVINKVDGTLLVGEDAPRRAELEMWLQGHPEFAVDPRFLAYM
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00057680-M11A
    Western Blot detection against Immunogen (36.63 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • CHD8
  • Gene Alias:
  • DKFZp686N17164,HELSNF1,KIAA1564
  • Gene Description:
  • chromodomain helicase DNA binding protein 8
  • Other Designations:
  • axis duplication inhibitor,beta-catenin binding protein-like,duplin,helicase with SNF2 domain 1
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook