Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GPAM polyclonal antibody (A01)

  • Catalog # : H00057678-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant GPAM.
  • Immunogen:
  • GPAM (NP_065969, 749 a.a. ~ 828 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PEYLQKLHKYLITRTERNVAVYAESATYCLVKNAVKMFKDIGVFKETKQKRVSVLELSSTFLPQCNRQKLLEYILSFVVL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00057678-A01
    Western Blot detection against Immunogen (34.91 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • GPAM
  • Gene Alias:
  • GPAT1,KIAA1560,MGC26846,RP11-426E5.2
  • Gene Description:
  • glycerol-3-phosphate acyltransferase, mitochondrial
  • Gene Summary:
  • Glycerol-3-phosphate acyltransferase (GPAT; EC 2.3.1.15), which catalyzes the initial and committing step in glycerolipid biosynthesis, is predicted to play a pivotal role in the regulation of cellular triacylglycerol and phospholipid levels. Two mammalian forms of GPAT have been identified on the basis of localization to either the endoplasmic reticulum or mitochondria.[supplied by OMIM
  • Other Designations:
  • glycerol 3-phosphate acyltransferase, mitochondrial,mitochondrial glycerol 3-phosphate acyltransferase
  • RSS
  • YouTube
  • Linkedin
  • Facebook