POGK monoclonal antibody (M01), clone 1A9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
POGK monoclonal antibody (M01), clone 1A9 Western Blot analysis of POGK expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of POGK expression in transfected 293T cell line by POGK monoclonal antibody (M01), clone 1A9.
Lane 1: POGK transfected lysate(69.4 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged POGK is approximately 1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to POGK on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant POGK.
Immunogen
POGK (NP_060012, 431 a.a. ~ 540 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEIRCHRYGWMTEDLMQDWLEVVWRRRTGAVPKQRGMLILNGFRGHATDSVKNSMESMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (92)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
POGK monoclonal antibody (M01), clone 1A9 Western Blot analysis of POGK expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of POGK expression in transfected 293T cell line by POGK monoclonal antibody (M01), clone 1A9.
Lane 1: POGK transfected lysate(69.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged POGK is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to POGK on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — POGK
Entrez GeneID
57645GeneBank Accession#
NM_017542Protein Accession#
NP_060012Gene Name
POGK
Gene Alias
BASS2, KIAA1513, KIAA15131, LST003
Gene Description
pogo transposable element with KRAB domain
Gene Ontology
HyperlinkGene Summary
The exact function of the protein encoded by this gene is not known. However, this gene product contains a KRAB domain (which is involved in protein-protein interactions) at the N-terminus, and a transposase domain at the C-terminus, suggesting that it may belong to the family of DNA-mediated transposons in human. [provided by RefSeq
Other Designations
OTTHUMP00000032214|OTTHUMP00000032216
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com