SH3MD2 monoclonal antibody (M01), clone 3H3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SH3MD2.
Immunogen
SH3MD2 (NP_065921, 790 a.a. ~ 888 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LAQDAFHRKASSLDSAVPIAPPPRQACSSLGPVLNESRPVVCERHRVVVSYPPQSEAELELKEGDIVFVHKKREDGWFKGTLQRNGKTGLFPGSFVENI
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SH3MD2 monoclonal antibody (M01), clone 3H3 Western Blot analysis of SH3MD2 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
SH3MD2 monoclonal antibody (M01), clone 3H3. Western Blot analysis of SH3MD2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SH3MD2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — SH3RF1
Entrez GeneID
57630GeneBank Accession#
NM_020870Protein Accession#
NP_065921Gene Name
SH3RF1
Gene Alias
FLJ21602, KIAA1494, POSH, RNF142, SH3MD2
Gene Description
SH3 domain containing ring finger 1
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein containing an N-terminus RING-finger, four SH3 domains, and a region implicated in binding of the Rho GTPase Rac. Via the RING-finger, the encoded protein has been shown to function as an ubiquitin-protein ligase involved in protein sorting at the trans-Golgi network. The encoded protein may also act as a scaffold for the c-Jun N-terminal kinase signaling pathway, facilitating the formation of a functional signaling module. [provided by RefSeq
Other Designations
SH3 multiple domains 2|plenty of SH3 domains|plenty of SH3s|ring finger protein 142
-
Interactome
-
Disease
-
Publication Reference
-
Oncogenic activation of PI3K induces progenitor cell differentiation to suppress epidermal growth.
Ying Z, Sandoval M, Beronja S.
Nature Cell Biology 2018 Nov; 20(11):1256.
Application:IP, WB, Mouse, E18.5 epidermis.
-
Protein interaction screening identifies SH3RF1 as a new regulator of FAT1 protein levels.
de Bock CE, Hughes MR, Snyder K, Alley S, Sadeqzadeh E, Dun MD, McNagny KM, Molloy TJ, Hondermarck H, Thorne RF.
FEBS Letters 2017 Feb; 591(4):667.
Application:WB, Human, HEK 293, MDA-MB-231 cells.
-
Sh3rf2/POSHER promotes cell survival by RING-mediated proteasomal degradation of the JNK scaffold POSH.
Wilhelm M, Kukekov NV, Schmit TL, Biagas KV, Sproul AA, Gire S, Maes ME, Xu Z, Greene LA.
The Journal of Biological Chemistry 2012 Jan; 287(3):2247.
Application:WB, Human, HEK 293 cells.
-
Oncogenic activation of PI3K induces progenitor cell differentiation to suppress epidermal growth.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com