Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DPP10 (Human) Recombinant Protein (Q01)

  • Catalog # : H00057628-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DPP10 partial ORF ( NP_065919.2, 122 a.a. - 192 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • FVTFKASRHSVSPDLKYVLLAYDVKQIFHYSYTASYVIYNIHTREVWELNPPEVEDSVLQYAAWGVQGQQL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33.55
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00057628-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • DPP10
  • Gene Alias:
  • DPL2,DPPY,DPRP3
  • Gene Description:
  • dipeptidyl-peptidase 10
  • Gene Summary:
  • This gene encodes a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Mutations in this gene have been associated with asthma. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
  • Other Designations:
  • dipeptidyl peptidase 10,dipeptidyl peptidase IV-related protein 3,dipeptidyl peptidase X,dipeptidyl peptidase like protein 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook