VPS18 monoclonal antibody (M01), clone 4F8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant VPS18.
Immunogen
VPS18 (NP_065908, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SILDEYENSLSRSAVLQPGCPSVGIPHSGYVNAQLEKEVPIFTKQRIDFTPSERITSLVVSSNQLCMSLGKDTLLRIDLGKANEPNHVELGRKDDAKV
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (89); Rat (89)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
VPS18 monoclonal antibody (M01), clone 4F8. Western Blot analysis of VPS18 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — VPS18
Entrez GeneID
57617GeneBank Accession#
NM_020857Protein Accession#
NP_065908Gene Name
VPS18
Gene Alias
KIAA1475, PEP3
Gene Description
vacuolar protein sorting 18 homolog (S. cerevisiae)
Omim ID
608551Gene Ontology
HyperlinkGene Summary
Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps18 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. [provided by RefSeq
Other Designations
vacuolar protein sorting 18|vacuolar protein sorting protein 18
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com