EBF4 monoclonal antibody (M04), clone 4E10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of EBF4 expression in transfected 293T cell line by EBF4 monoclonal antibody (M04), clone 4E10.
Lane 1: EBF4 transfected lysate (Predicted MW: 9.1 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EBF4 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.5 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant EBF4.
Immunogen
EBF4 (AAH54347.1, 1 a.a. ~ 88 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPSSPPLAAASSMSLPAAAPTTSVFSFSPVNMISAVKQRSAFAPVLRPPSSPPQACPRAHGEGLPDQSFEDSDKFHSPARGLQGLAYS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.5 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of EBF4 expression in transfected 293T cell line by EBF4 monoclonal antibody (M04), clone 4E10.
Lane 1: EBF4 transfected lysate (Predicted MW: 9.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EBF4 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — EBF4
Entrez GeneID
57593GeneBank Accession#
BC054347.1Protein Accession#
AAH54347.1Gene Name
EBF4
Gene Alias
COE4, KIAA1442, O/E-4
Gene Description
early B-cell factor 4
Omim ID
609935Gene Ontology
HyperlinkGene Summary
EBF4 belongs to the conserved Olf/EBF family of helix-loop-helix transcription factors, members of which play important roles in neural development and B-cell maturation (Wang et al., 2002 [PubMed 12139918]).[supplied by OMIM
Other Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com