PCDH10 monoclonal antibody (M01), clone 4H8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PCDH10.
Immunogen
PCDH10 (NP_065866, 18 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SQLHYTVQEEQEHGTFVGNIAEDLGLDITKLSARGFQTVPNSRTPYLDLNLETGVLYVNEKIDREQICKQSPSCVLHLEVFLENPLELFQVEIEVLDINDNPPSFPEPDL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PCDH10 monoclonal antibody (M01), clone 4H8. Western Blot analysis of PCDH10 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of PCDH10 expression in transfected 293T cell line by PCDH10 monoclonal antibody (M01), clone 4H8.
Lane 1: PCDH10 transfected lysate(112.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PCDH10 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — PCDH10
Entrez GeneID
57575GeneBank Accession#
NM_020815Protein Accession#
NP_065866Gene Name
PCDH10
Gene Alias
DKFZp761O2023, KIAA1400, MGC133344, OL-PCDH, PCDH19
Gene Description
protocadherin 10
Omim ID
608286Gene Ontology
HyperlinkGene Summary
This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The mRNA encodes a cadherin-related neuronal receptor thought to play a role in the establishment and function of specific cell-cell connections in the brain. This family member contains 6 extracellular cadherin domains, a transmembrane domain and a cytoplasmic tail differing from those of the classical cadherins. Alternatively spliced transcripts encode isoforms with unique cytoplasmic domains. [provided by RefSeq
Other Designations
ortholog of OL-pcdh
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com