SORCS2 monoclonal antibody (M03), clone 1D7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SORCS2 monoclonal antibody (M03), clone 1D7. Western Blot analysis of SORCS2 expression in HepG2(Cat # L019V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SORCS2 is 0.1 ng/ml as a capture antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SORCS2.
Immunogen
SORCS2 (NP_065828.1, 802 a.a. ~ 900 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VLRVLDQFQVMPLQFSKELDAYNPNTPEWREDVGLVVTRLLSKETSVPQELLVTVVKPGLPTLADLYVLLPPPRPTRKRSLSSDKRLAAIQQVLNAQKI
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SORCS2 monoclonal antibody (M03), clone 1D7. Western Blot analysis of SORCS2 expression in HepG2(Cat # L019V1 ).Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SORCS2 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — SORCS2
Entrez GeneID
57537GeneBank Accession#
NM_020777.1Protein Accession#
NP_065828.1Gene Name
SORCS2
Gene Alias
-
Gene Description
sortilin-related VPS10 domain containing receptor 2
Omim ID
606284Gene Ontology
HyperlinkGene Summary
This gene encodes one family member of vacuolar protein sorting 10 (VPS10) domain-containing receptor proteins. The VPS10 domain name comes from the yeast carboxypeptidase Y sorting receptor Vps10 protein. Members of this gene family are large with many exons but the CDS lengths are usually less than 3700 nt. Very large introns typically separate the exons encoding the VPS10 domain; the remaining exons are separated by much smaller-sized introns. These genes are strongly expressed in the central nervous system. [provided by RefSeq
Other Designations
VPS10 domain receptor protein|VPS10 domain receptor protein SORCS 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com