Product Browser

Last updated: 2017/10/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PCDH19 (Human) Recombinant Protein (Q01)

  • Catalog # : H00057526-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PCDH19 partial ORF (NP_065817.1, 241 a.a. - 340 a.a.) recombinant protein with GST tag at N-terminal.
  • Sequence:
  • RLVPRDVEETDKMNVVSCSSLTSSLNYFDYHQQTLPLGCRRSESTFLNVENQNTRNTSANHIYHHSFNSQGPQQPDLIINGAPLPETENYSFDSNYVNSR
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue

    QC Testing of H00057526-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • PCDH19
  • Gene Alias:
  • DKFZp686P1843,EFMR,KIAA1313
  • Gene Description:
  • protocadherin 19
  • Gene Summary:
  • Protocadherins form a subfamily of calcium-dependent cell-cell adhesion molecules in the cadherin superfamily. Protocadherin-10 belongs to a subclass of protocadherins that share a highly conserved 17-amino acid cytoplasmic motif (Wolverton and Lalande, 2001 [PubMed 11549318]). PCDH19 belongs to the delta-2 protocadherin subclass of the cadherin superfamily (Dibbens et al., 2008) [PubMed 18469813].[supplied by OMIM
  • Other Designations:
  • epilepsy, female restricted, with mental retardation (Juberg-Hellman syndrome)
  • RSS
  • YouTube
  • Linkedin
  • Facebook