COG6 monoclonal antibody (M01), clone 5B5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant COG6.
Immunogen
COG6 (NP_065802, 558 a.a. ~ 657 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QQHKPEQGSLANMPNLDSVTLKAAMVQFDRYLSAPDNLLIPQLNFLLSATVKEQIVKQSTELVCRAYGEVYAAVMNPINEYKDPENILHRSPQQVQTLLS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (85)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
COG6 monoclonal antibody (M01), clone 5B5 Western Blot analysis of COG6 expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged COG6 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — COG6
Entrez GeneID
57511GeneBank Accession#
NM_020751Protein Accession#
NP_065802Gene Name
COG6
Gene Alias
COD2, DKFZp313D191, KIAA1134
Gene Description
component of oligomeric golgi complex 6
Omim ID
606977Gene Ontology
HyperlinkGene Summary
This gene encodes a subunit of the conserved oligomeric Golgi complex that is required for maintaining normal structure and activity of the Golgi apparatus. The encoded protein is organized with conserved oligomeric Golgi complex components 5, 7 and 8 into a sub-complex referred to as lobe B. Alternative splicing results in multiple transcript variants
Other Designations
complexed with Dor1p 2|conserved oligomeric Golgi complex protein 6
-
Interactome
-
Publication Reference
-
A genome-wide association study of psoriasis and psoriatic arthritis identifies new disease Loci.
Liu Y, Helms C, Liao W, Zaba LC, Duan S, Gardner J, Wise C, Miner A, Malloy MJ, Pullinger CR, Kane JP, Saccone S, Worthington J, Bruce I, Kwok PY, Menter A, Krueger J, Barton A, Saccone NL, Bowcock AM.
PLoS Genetics 2008 Mar; 4(3):e1000041.
Application:IHC, Human, Non-lesional and lesional skin tissues from patients with Psoriasis and Psoriatic Arthritis.
-
A genome-wide association study of psoriasis and psoriatic arthritis identifies new disease Loci.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com